PDB entry 1dr3

View 1dr3 on RCSB PDB site
Description: 2.3 angstroms crystal structure of chicken liver dihydrofolate reductase complexed with thionadp+ and biopterin
Deposited on 1992-03-14, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.14
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1dr3__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dr3_ (-)
    vrslnsivavcqnmgigkdgnlpwpplrneykyfqrmtstshvegkqnavimgkktwfsi
    peknrplkdrinivlsrelkeapkgahylskslddalalldspelkskvdmvwivggtav
    ykaamekpinhrlfvtrilhefesdtffpeidykdfkllteypgvpadiqeedgiqykfe
    vyqksv