PDB entry 1dr2

View 1dr2 on RCSB PDB site
Description: 2.3 angstroms crystal structure of chicken liver dihydrofolate reductase complexed with thionadp+ and biopterin
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1992-03-14, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dr2a_
  • Heterogens: CA, TAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dr2A (A:)
    vrslnsivavcqnmgigkdgnlpwpplrneykyfqrmtstshvegkqnavimgkktwfsi
    peknrplkdrinivlsrelkeapkgahylskslddalalldspelkskvdmvwivggtav
    ykaamekpinhrlfvtrilhefesdtffpeidykdfkllteypgvpadiqeedgiqykfe
    vyqksvlaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dr2A (A:)
    vrslnsivavcqnmgigkdgnlpwpplrneykyfqrmtstshvegkqnavimgkktwfsi
    peknrplkdrinivlsrelkeapkgahylskslddalalldspelkskvdmvwivggtav
    ykaamekpinhrlfvtrilhefesdtffpeidykdfkllteypgvpadiqeedgiqykfe
    vyqksv