PDB entry 1dr0

View 1dr0 on RCSB PDB site
Description: structure of modified 3-isopropylmalate dehydrogenase at the c-terminus, hd708
Class: oxidoreductase
Keywords: dehydrogenase, minor groove, paperclip motion, OXIDOREDUCTASE
Deposited on 2000-01-06, released 2000-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-isopropylmalate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: LEUB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SIY4 (0-344)
      • see remark 999 (84)
      • see remark 999 (171)
      • see remark 999 (340-345)
    Domains in SCOPe 2.07: d1dr0a_
  • Chain 'B':
    Compound: 3-isopropylmalate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: LEUB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SIY4 (0-344)
      • see remark 999 (84)
      • see remark 999 (171)
      • see remark 999 (340-345)
    Domains in SCOPe 2.07: d1dr0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dr0A (A:)
    mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
    veeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplke
    eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafelarkrrkhv
    vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg
    dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
    afglvelarkvedavakalletpppdlggsagteaftatvtatvgi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dr0B (B:)
    mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
    veeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplke
    eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafelarkrrkhv
    vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg
    dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
    afglvelarkvedavakalletpppdlggsagteaftatvtatvgi