PDB entry 1dqz

View 1dqz on RCSB PDB site
Description: crystal structure of antigen 85c from mycobacterium tuberculosis
Deposited on 2000-01-05, released 2000-07-12
The last revision prior to the SCOP 1.71 freeze date was dated 2000-07-12, with a file datestamp of 2000-07-12.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.166
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1dqza_
  • Chain 'B':
    Domains in SCOP 1.71: d1dqzb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dqzA (A:)
    rpglpveylqvpsasmgrdikvqfqgggphavylldglraqddyngwdintpafeeyyqs
    glsvimpvggqssfytdwyqpsqsngqnytykwetfltrempawlqankgvsptgnaavg
    lsmsggsalilaayypqqfpyaaslsgflnpseswwptliglamndsggynansmwgpss
    dpawkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegltlrtnqtfrdty
    aadggrngvfnfppngthswpywneqlvamkadiqhvlng
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dqzB (B:)
    rpglpveylqvpsasmgrdikvqfqgggphavylldglraqddyngwdintpafeeyyqs
    glsvimpvggqssfytdwyqpsqsngqnytykwetfltrempawlqankgvsptgnaavg
    lsmsggsalilaayypqqfpyaaslsgflnpseswwptliglamndsggynansmwgpss
    dpawkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegltlrtnqtfrdty
    aadggrngvfnfppngthswpywneqlvamkadiqhvlng