PDB entry 1dqy

View 1dqy on RCSB PDB site
Description: crystal structure of antigen 85c from mycobacterium tuberculosis with diethyl phosphate inhibitor
Class: immune system
Keywords: ANTIGEN, 85C, MYCOBACTERIUM TUBERCULOSIS, FIBRONECTIN, DPI, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, IMMUNE SYSTEM
Deposited on 2000-01-05, released 2000-07-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.168
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (antigen 85-c)
  Species: Mycobacterium tuberculosis [TaxId:1773]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A4V4 (0-282)
    • conflict (0)
    • conflict (156)
  Domains in SCOPe 2.08: d1dqya_
• Heterogens: DEP, MRD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dqyA (A:)
  mfsrpglpveylqvpsasmgrdikvqfqgggphavylldglraqddyngwdintpafeey
  yqsglsvimpvggqssfytdwyqpsqsngqnytykwetfltrempawlqankgvsptgna
  avglsmsggsalilaayypqqfpyaaslsgflnpseswwptliglamndsggynansmwg
  pssdpawkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegltlrtnqtfr
  dtyaadggrngvfnfppngthswpywneqlvamkadiqhvlng