PDB entry 1dqx

View 1dqx on RCSB PDB site
Description: crystal structure of orotidine 5'-phosphate decarboxylase complexed to 6-hydroxyuridine 5'-phosphate (bmp)
Class: lyase
Keywords: orotidine 5'phosphate decarboxylase, uridine 5'phosphate, UMP, OMP, 6-hydroxyuridine 5'-phosphate, BMP, TIM barrel, LYASE
Deposited on 2000-01-05, released 2000-03-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03962 (0-266)
      • engineered (1)
      • engineered (266)
    Domains in SCOPe 2.06: d1dqxa_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03962 (0-266)
      • engineered (1)
      • engineered (266)
    Domains in SCOPe 2.06: d1dqxb_
  • Chain 'C':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03962 (0-266)
      • engineered (1)
      • engineered (266)
    Domains in SCOPe 2.06: d1dqxc_
  • Chain 'D':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03962 (0-266)
      • engineered (1)
      • engineered (266)
    Domains in SCOPe 2.06: d1dqxd_
  • Heterogens: BMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dqxA (A:)
    mhkatykeraathpspvaaklfnimhekqtnlcasldvrttkellelvealgpkicllkt
    hvdiltdfsmegtvkplkalsakynfllfedrkfadigntvklqysagvyriaewaditn
    ahgvvgpgivsglkqaaeevtkeprgllmlaelsckgslstgeytkgtvdiaksdkdfvi
    gfiaqrdmggrdegydwlimtpgvglddkgdalgqqyrtvddvvstgsdiiivgrglfak
    grdakvegeryrkagweaylrrcgqqd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dqxB (B:)
    mhkatykeraathpspvaaklfnimhekqtnlcasldvrttkellelvealgpkicllkt
    hvdiltdfsmegtvkplkalsakynfllfedrkfadigntvklqysagvyriaewaditn
    ahgvvgpgivsglkqaaeevtkeprgllmlaelsckgslstgeytkgtvdiaksdkdfvi
    gfiaqrdmggrdegydwlimtpgvglddkgdalgqqyrtvddvvstgsdiiivgrglfak
    grdakvegeryrkagweaylrrcgqqd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dqxC (C:)
    mhkatykeraathpspvaaklfnimhekqtnlcasldvrttkellelvealgpkicllkt
    hvdiltdfsmegtvkplkalsakynfllfedrkfadigntvklqysagvyriaewaditn
    ahgvvgpgivsglkqaaeevtkeprgllmlaelsckgslstgeytkgtvdiaksdkdfvi
    gfiaqrdmggrdegydwlimtpgvglddkgdalgqqyrtvddvvstgsdiiivgrglfak
    grdakvegeryrkagweaylrrcgqqd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dqxD (D:)
    mhkatykeraathpspvaaklfnimhekqtnlcasldvrttkellelvealgpkicllkt
    hvdiltdfsmegtvkplkalsakynfllfedrkfadigntvklqysagvyriaewaditn
    ahgvvgpgivsglkqaaeevtkeprgllmlaelsckgslstgeytkgtvdiaksdkdfvi
    gfiaqrdmggrdegydwlimtpgvglddkgdalgqqyrtvddvvstgsdiiivgrglfak
    grdakvegeryrkagweaylrrcgqqd