PDB entry 1dqv

View 1dqv on RCSB PDB site
Description: crystal structure of synaptotagmin III c2a/c2b
Class: endocytosis/exocytosis
Keywords: beta sandwich, calcium ion, C2 domain, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2000-01-05, released 2000-01-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.293
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: synaptotagmin III
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dqva1, d1dqva2
  • Heterogens: MG, SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dqvA (A:)
    eagapcgrisfalrylygsdqlvvrilqaldlpakdsngfsdpyvkiyllpdrkkkfqtk
    vhrktlnpifnetfqfsvplaelaqrklhfsvydfdrfsrhdligqvvldnllelaeqpp
    drplwrdileggsekadlgelnfslcylptaglltvtiikasnlkamdltgfsdpyvkas
    lisegrrlkkrktsikkntlnptynealvfdvapesvenvglsiavvdydcighnevigv
    crvgpeaadphgrehwaemlanprkpvehwhqlveektlssftkggkglsekense
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dqvA (A:)
    gapcgrisfalrylygsdqlvvrilqaldlpakdsngfsdpyvkiyllpdrkkkfqtkvh
    rktlnpifnetfqfsvplaelaqrklhfsvydfdrfsrhdligqvvldnllelaeqppdr
    plwrdileggsekadlgelnfslcylptaglltvtiikasnlkamdltgfsdpyvkasli
    segrrlkkrktsikkntlnptynealvfdvapesvenvglsiavvdydcighnevigvcr
    vgpeaadphgrehwaemlanprkpvehwhqlveek