PDB entry 1dqv

View 1dqv on RCSB PDB site
Description: crystal structure of synaptotagmin iii c2a/c2b
Deposited on 2000-01-05, released 2000-01-19
The last revision prior to the SCOP 1.69 freeze date was dated 2000-01-19, with a file datestamp of 2000-01-18.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.293
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dqvA (A:)
    eagapcgrisfalrylygsdqlvvrilqaldlpakdsngfsdpyvkiyllpdrkkkfqtk
    vhrktlnpifnetfqfsvplaelaqrklhfsvydfdrfsrhdligqvvldnllelaeqpp
    drplwrdileggsekadlgelnfslcylptaglltvtiikasnlkamdltgfsdpyvkas
    lisegrrlkkrktsikkntlnptynealvfdvapesvenvglsiavvdydcighnevigv
    crvgpeaadphgrehwaemlanprkpvehwhqlveektlssftkggkglsekense
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dqvA (A:)
    gapcgrisfalrylygsdqlvvrilqaldlpakdsngfsdpyvkiyllpdrkkkfqtkvh
    rktlnpifnetfqfsvplaelaqrklhfsvydfdrfsrhdligqvvldnllelaeqppdr
    plwrdileggsekadlgelnfslcylptaglltvtiikasnlkamdltgfsdpyvkasli
    segrrlkkrktsikkntlnptynealvfdvapesvenvglsiavvdydcighnevigvcr
    vgpeaadphgrehwaemlanprkpvehwhqlveek