PDB entry 1dqt

View 1dqt on RCSB PDB site
Description: the crystal structure of murine ctla4 (cd152)
Class: immune system
Keywords: immunoglobulin variable domain-like beta-sandwich, homodimer, IMMUNE SYSTEM
Deposited on 2000-01-05, released 2000-10-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytotoxic t lymphocyte associated antigen 4
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09793 (0-116)
  Domains in SCOPe 2.08: d1dqta_
• Chain 'B':
  Compound: cytotoxic t lymphocyte associated antigen 4
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09793 (0-116)
  Domains in SCOPe 2.08: d1dqtb_
• Chain 'C':
  Compound: cytotoxic t lymphocyte associated antigen 4
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09793 (0-116)
  Domains in SCOPe 2.08: d1dqtc_
• Chain 'D':
  Compound: cytotoxic t lymphocyte associated antigen 4
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09793 (0-116)
  Domains in SCOPe 2.08: d1dqtd_
• Heterogens: CL, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dqtA (A:)
  iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
  ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvidp
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dqtB (B:)
  iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
  ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvidp
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dqtC (C:)
  iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
  ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvidp
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dqtD (D:)
  iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
  ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvidp