PDB entry 1dqt

View 1dqt on RCSB PDB site
Description: the crystal structure of murine ctla4 (cd152)
Class: immune system
Keywords: immunoglobulin variable domain-like beta-sandwich, homodimer, IMMUNE SYSTEM
Deposited on 2000-01-05, released 2000-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.211
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytotoxic t lymphocyte associated antigen 4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dqta_
  • Chain 'B':
    Compound: cytotoxic t lymphocyte associated antigen 4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dqtb_
  • Chain 'C':
    Compound: cytotoxic t lymphocyte associated antigen 4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dqtc_
  • Chain 'D':
    Compound: cytotoxic t lymphocyte associated antigen 4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dqtd_
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dqtA (A:)
    iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
    ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvidp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dqtB (B:)
    iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
    ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvidp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dqtC (C:)
    iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
    ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvidp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dqtD (D:)
    iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
    ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvidp