PDB entry 1dqp

View 1dqp on RCSB PDB site
Description: crystal structure of giardia guanine phosphoribosyltransferase complexed with immucilling
Class: transferase
Keywords: protein-inhibitor complex, immucillinG, 9-deazaguanine, TRANSFERASE
Deposited on 2000-01-04, released 2000-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.204
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanine phosphoribosyltransferase
    Species: Giardia intestinalis [TaxId:5741]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dqpa_
  • Chain 'B':
    Compound: guanine phosphoribosyltransferase
    Species: Giardia intestinalis [TaxId:5741]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dqpb_
  • Heterogens: IMG, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dqpA (A:)
    micsvtgkpvkdvlstffkdrndvlesevkkfhllatfeeckalaadtarrmneyykdva
    epvtlvalltgaylyaslltvhltfpytlhfvkvssykgtrqesvvfdeedlkqlkekre
    vvlideyvdsghtifsiqeqikhakicscfvkdvdaikkhsaladtkmfygytpmpkgsw
    ligfglddnglrrgwahlfdinlsesevtefrrrltehikglningvnry
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dqpB (B:)
    micsvtgkpvkdvlstffkdrndvlesevkkfhllatfeeckalaadtarrmneyykdva
    epvtlvalltgaylyaslltvhltfpytlhfvkvssykgtrqesvvfdeedlkqlkekre
    vvlideyvdsghtifsiqeqikhakicscfvkdvdaikkhsaladtkmfygytpmpkgsw
    ligfglddnglrrgwahlfdinlsesevtefrrrltehikglningvnry