PDB entry 1dql

View 1dql on RCSB PDB site
Description: crystal structure of an unliganded (native) fv from a human igm anti-peptide antibody
Class: immune system
Keywords: IMMUNOGLOBULIN FOLD, ANTIBODY, IgM, Fv, IMMUNE SYSTEM
Deposited on 2000-01-04, released 2000-10-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.181
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igm mez immunoglobulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1DQL (0-122)
    Domains in SCOPe 2.03: d1dqlh_
  • Chain 'L':
    Compound: igm mez immunoglobulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1DQL (0-105)
    Domains in SCOPe 2.03: d1dqll_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dqlH (H:)
    evqlvesggglvqpggslrlscaasgftfssyamhwvrqapgkglewvavissdggnkyy
    tdsvkgrftisrndskntlylqmnslrtedtavfycargnppyssgwgggdywgqgtmvt
    vss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dqlL (L:)
    diqmtqspsslsasvgdrvtitcrasqdirndlgwyqqkpgkapkkliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyyclqqnsnwtfgqgtkvdik