PDB entry 1dql

View 1dql on RCSB PDB site
Description:
Deposited on 2000-01-04, released 2000-10-04
The last revision prior to the SCOP 1.67 freeze date was dated 2000-10-04, with a file datestamp of 2000-10-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.181
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1dqlh_
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1dqll_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dqlH (H:)
    evqlvesggglvqpggslrlscaasgftfssyamhwvrqapgkglewvavissdggnkyy
    tdsvkgrftisrndskntlylqmnslrtedtavfycargnppyssgwgggdywgqgtmvt
    vss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dqlL (L:)
    diqmtqspsslsasvgdrvtitcrasqdirndlgwyqqkpgkapkkliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyyclqqnsnwtfgqgtkvdik