PDB entry 1dqg

View 1dqg on RCSB PDB site
Description: crystal structure of the cysteine rich domain of mannose receptor
Class: sugar binding protein
Keywords: beta trefoil, multilectin receptor, pituitary hormones, sulfated carbohydrate, SUGAR BINDING PROTEIN
Deposited on 2000-01-04, released 2000-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.196
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannose receptor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dqga_
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dqgA (A:)
    ldarqfliynedhkrcvdalsaisvqtatcnpeaesqkfrwvsdsqimsvafklclgvps
    ktdwasvtlyacdskseyqkweckndtlfgikgtelyfnygnrqekniklykgsglwsrw
    kvygttddlcsrgye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dqgA (A:)
    darqfliynedhkrcvdalsaisvqtatcnpeaesqkfrwvsdsqimsvafklclgvpsk
    tdwasvtlyacdskseyqkweckndtlfgikgtelyfnygnrqekniklykgsglwsrwk
    vygttddlcsrgye