PDB entry 1dqd

View 1dqd on RCSB PDB site
Description:
Deposited on 2000-01-04, released 2000-05-10
The last revision prior to the SCOP 1.65 freeze date was dated 2000-05-10, with a file datestamp of 2000-05-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1dqdh1, d1dqdh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1dqdl1, d1dqdl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1dqdH (H:)
    evqlqesgpslvkpsqtlsltcsvtgdsitsgywnwirkfpgnkleymgyisysgstyyn
    pslksrlsitrdtsrnqyylqlksvtpedtatyycasppgyygsgpyamdywgqgtsvtv
    ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkispg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dqdH (H:)
    evqlqesgpslvkpsqtlsltcsvtgdsitsgywnwirkfpgnkleymgyisysgstyyn
    pslksrlsitrdtsrnqyylqlksvtpedtatyycasppgyygsgpyamdywgqgtsvtv
    ssakttppsvyplapgsaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpsstwpsetvtcnvahpasstkvdkkispg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1dqdL (L:)
    aaqpamadivlsqspaimsaspgekvtitcsasssvsymhwfqqkpgtspklciyttsnl
    asgvparfsgsgsgtsysltisrmeaedaatyycqqrstypptfgsgtkleikradaapt
    vsifppsseqltsggasvvcflnnfyprdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrneca
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dqdL (L:)
    divlsqspaimsaspgekvtitcsasssvsymhwfqqkpgtspklciyttsnlasgvpar
    fsgsgsgtsysltisrmeaedaatyycqqrstypptfgsgtkleikradaaptvsifpps
    seqltsggasvvcflnnfyprdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrneca