PDB entry 1dqc

View 1dqc on RCSB PDB site
Description: solution structure of tachycitin, an antimicrobial protein with chitin-binding function
Class: antimicrobial protein
Keywords: disulfide-rich, ANTIMICROBIAL PROTEIN
Deposited on 2000-01-04, released 2000-09-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tachycitin
  Species: Tachypleus tridentatus [TaxId:6853]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P91818 (0-72)
  Domains in SCOPe 2.08: d1dqca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dqcA (A:)
  ylafrcgryspclddgpnvnlysccsfynchkclarlencpkglhynaylkvcdwpskag
  ctsvnkechlwkt