PDB entry 1dq7

View 1dq7 on RCSB PDB site
Description: three-dimensional structure of a neurotoxin from red scorpion (buthus tamulus) at 2.2a resolution.
Class: toxin
Keywords: Red scorpion Neurotoxin
Deposited on 1999-12-30, released 2000-12-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.201
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurotoxin
    Species: Mesobuthus tamulus [TaxId:34647]
    Database cross-references and differences (RAF-indexed):
    • PDB 1DQ7 (0-63)
    Domains in SCOPe 2.08: d1dq7a_
  • Chain 'B':
    Compound: Neurotoxin
    Species: Mesobuthus tamulus [TaxId:34647]
    Database cross-references and differences (RAF-indexed):
    • PDB 1DQ7 (0-63)
    Domains in SCOPe 2.08: d1dq7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dq7A (A:)
gedgyiadgdnctyictfnnychalctdkkgdsgacdwwvpygvvcwcedlptpvpirgs
gkcr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dq7B (B:)
gedgyiadgdnctyictfnnychalctdkkgdsgacdwwvpygvvcwcedlptpvpirgs
gkcr