PDB entry 1dq5

View 1dq5 on RCSB PDB site
Description: Manganese;Manganese concanavalin A at pH 5.0
Class: sugar binding protein
Keywords: concanavalin A, lecin, metal binding, manganese, binuclear
Deposited on 1999-12-30, released 2000-01-19
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: manganese;manganese concanavalin a (ph 5.0)
    Species: Canavalia ensiformis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02866 (118-236)
      • see remark 999 (150)
      • see remark 999 (154)
    Domains in SCOP 1.75: d1dq5a_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dq5A (A:)
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan