PDB entry 1dq4

View 1dq4 on RCSB PDB site
Description: A transient unlocked concanavalin A structure with MN2+ bound in the transition metal ion binding site S1 and an empty calcium binding site S2
Class: sugar binding protein
Keywords: concanavalin A, lectin, metal binding, transient, transition metal, manganese, SUGAR BINDING PROTEIN
Deposited on 1999-12-30, released 2000-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Concanavalin-Br
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55915 (0-236)
      • conflict (57)
      • conflict (69)
      • conflict (150)
      • conflict (154)
    Domains in SCOPe 2.07: d1dq4a_
  • Chain 'B':
    Compound: Concanavalin-Br
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55915 (0-236)
      • conflict (57)
      • conflict (69)
      • conflict (150)
      • conflict (154)
    Domains in SCOPe 2.07: d1dq4b_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dq4A (A:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dq4A (A:)
    adtivaveldtypnpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkrlsavv
    sypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnsthetna
    lhfmfnqfskdqkdlilqgdattgtdgnleltrvqgssvgralfyapvhiwessavvasf
    eatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dq4B (B:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dq4B (B:)
    adtivaveldtyppsyphigidiksvrskktakwnmqngkvgtahiiynsvdkrlsavvs
    ypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnsthetnal
    hfmfnqfskdqkdlilqgdattgtdgnleltrvssvgralfyapvhiwessavvasfeat
    ftflikspdshpadgiaffisnidssipsgstgrllglfpdan