PDB entry 1dq3

View 1dq3 on RCSB PDB site
Description: crystal structure of an archaeal intein-encoded homing endonuclease pi-pfui
Class: hydrolase
Keywords: Endonuclease, PI-PfuI, Intein-encoded
Deposited on 1999-12-30, released 2000-07-05
The last revision prior to the SCOP 1.73 freeze date was dated 2000-07-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.192
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endonuclease
    Species: PYROCOCCUS FURIOSUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1dq3a1, d1dq3a2, d1dq3a3, d1dq3a4
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dq3A (A:)
    cidgkakiifenegeehlttmeemyerykhlgefydeeynrwgidvsnvpiyvksfdpes
    krvvkgkvnviwkyelgkdvtkyeiitnkgtkiltspwhpffvltpdfkivekradelke
    gdiliggmpdgedykfifdywlagfiagdgcfdkyhshvkgheyiydrlriydyrietfe
    iindylektfgrkysiqkdrniyyidikarnitshylkllegidngippqilkegknavl
    sfiaglfdaeghvsnkpgielgmvnkrliedvthylnalgikarireklrkdgidyvlhv
    eeyssllrfyeligknlqneekreklekvlsnhkggnfglplnfnafkewaseygvefkt
    ngsqtiaiinderislgqwhtrnrvskavlvkmlrklyeatkdeevkrmlhlieglevvr
    hitttneprtfydltvenyqnylagengmifvhn