PDB entry 1dq3

View 1dq3 on RCSB PDB site
Description: crystal structure of an archaeal intein-encoded homing endonuclease pi-pfui
Deposited on 1999-12-30, released 2000-07-05
The last revision prior to the SCOP 1.69 freeze date was dated 2000-07-28, with a file datestamp of 2000-07-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.192
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dq3A (A:)
    cidgkakiifenegeehlttmeemyerykhlgefydeeynrwgidvsnvpiyvksfdpes
    krvvkgkvnviwkyelgkdvtkyeiitnkgtkiltspwhpffvltpdfkivekradelke
    gdiliggmpdgedykfifdywlagfiagdgcfdkyhshvkgheyiydrlriydyrietfe
    iindylektfgrkysiqkdrniyyidikarnitshylkllegidngippqilkegknavl
    sfiaglfdaeghvsnkpgielgmvnkrliedvthylnalgikarireklrkdgidyvlhv
    eeyssllrfyeligknlqneekreklekvlsnhkggnfglplnfnafkewaseygvefkt
    ngsqtiaiinderislgqwhtrnrvskavlvkmlrklyeatkdeevkrmlhlieglevvr
    hitttneprtfydltvenyqnylagengmifvhn