PDB entry 1dq2

View 1dq2 on RCSB PDB site
Description: Unlocked metal-free concanavalin A
Class: sugar binding protein
Keywords: demetallized, LECTIN, metal-free, unlocked, concanavalin A, SUGAR BINDING PROTEIN
Deposited on 1999-12-29, released 2000-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Concanavalin-Br
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55915 (0-236)
      • conflict (57)
      • conflict (69)
      • conflict (150)
      • conflict (154)
    Domains in SCOPe 2.07: d1dq2a_
  • Chain 'B':
    Compound: Concanavalin-Br
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55915 (0-End)
      • conflict (57)
      • conflict (69)
      • conflict (150)
      • conflict (154)
    Domains in SCOPe 2.07: d1dq2b_
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dq2A (A:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dq2A (A:)
    adtivaveldtypntphigidiksvrskktakwnmqngkvgtahiiynsvdkrlsavvsy
    pnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnsthetnalh
    fmfnqfskdqkdlilqgdattgtdgnleltrvsgssvgralfyapvhiwessavvasfea
    tftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dq2B (B:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dq2B (B:)
    adtivaveldtypsyphigidiksvrskktakwnmqngkvgtahiiynsvdkrlsavvsy
    pnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnsthetnalh
    fmfnqfskdqkdlilqgdattgtdgnleltrvgssvgralfyapvhiwessavvasfeat
    ftflikspdshpadgiaffisnidssipsgstgrllglfp