PDB entry 1dq1

View 1dq1 on RCSB PDB site
Description: Calcium;Calcium concanavalin A
Class: sugar binding protein
Keywords: beta-sheet, Leguminosae lectin, calcium, transition metal, ion binding site, S1, calcium binding site, S2
Deposited on 1999-12-29, released 2000-01-19
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.182
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcium;calcium concanavalin a
    Species: Canavalia ensiformis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02866 (118-236)
      • see remark 999 (150)
      • see remark 999 (154)
    Domains in SCOP 1.75: d1dq1a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dq1A (A:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan