PDB entry 1dpz

View 1dpz on RCSB PDB site
Description: structure of modified 3-isopropylmalate dehydrogenase at the c-terminus, hd711
Class: oxidoreductase
Keywords: dehydrogenase, minor groove, paperclip motion, oxidoreductase
Deposited on 1999-12-29, released 2000-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-isopropylmalate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: LEUB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SIY4 (0-344)
      • see remark 999 (84)
      • see remark 999 (171)
      • see remark 999 (340-344)
    Domains in SCOPe 2.07: d1dpza_
  • Chain 'B':
    Compound: 3-isopropylmalate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: LEUB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SIY4 (0-End)
      • see remark 999 (84)
      • see remark 999 (171)
      • see remark 999 (340-343)
    Domains in SCOPe 2.07: d1dpzb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dpzA (A:)
    mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
    veeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplke
    eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafelarkrrkhv
    vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg
    dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
    afglvelarkvedavakalletpppdlggsagteaftatveaftatvgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dpzA (A:)
    mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
    veeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplke
    eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafelarkrrkhv
    vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg
    dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
    afglvelarkvedavakalletpppdlggsagteaftatveafta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dpzB (B:)
    mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
    veeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplke
    eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafelarkrrkhv
    vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg
    dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
    afglvelarkvedavakalletpppdlggsagteaftatveaftatvgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dpzB (B:)
    mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
    veeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplke
    eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafelarkrrkhv
    vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg
    dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
    afglvelarkvedavakalletpppdlggsagteaftatveaft