PDB entry 1dpy

View 1dpy on RCSB PDB site
Description: three-dimensional structure of a novel phospholipase a2 from indian common krait at 2.45 a resolution
Deposited on 1999-12-28, released 2000-06-28
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-28, with a file datestamp of 2000-06-28.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.202
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1dpya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dpyA (A:)
  nliqfknmiqcagtriwtayvaygcycgkggsgtpvdeldrccythdhcyneaekipgcn
  pniktysytctqpnltctdsadtcaqflcecdrtaaicfasapynsnnimlsstscq