PDB entry 1dpy

View 1dpy on RCSB PDB site
Description: three-dimensional structure of a novel phospholipase a2 from indian common krait at 2.45 a resolution
Class: hydrolase
Keywords: indian common krait venom, phospholipase a2, crystal structure, refinement, hydrolase
Deposited on 1999-12-28, released 2000-06-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.202
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Bungarus caeruleus [TaxId:132961]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9DF52 (0-115)
      • conflict (15)
      • conflict (21)
      • conflict (47)
      • conflict (71)
      • conflict (79)
      • conflict (85)
      • conflict (89)
      • conflict (108)
      • conflict (115)
    Domains in SCOPe 2.08: d1dpya_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dpyA (A:)
    nliqfknmiqcagtriwtayvaygcycgkggsgtpvdeldrccythdhcyneaekipgcn
    pniktysytctqpnltctdsadtcaqflcecdrtaaicfasapynsnnimlssstscq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dpyA (A:)
    nliqfknmiqcagtriwtayvaygcycgkggsgtpvdeldrccythdhcyneaekipgcn
    pniktysytctqpnltctdsadtcaqflcecdrtaaicfasapynsnnimlsstscq