PDB entry 1dpu

View 1dpu on RCSB PDB site
Description: solution structure of the c-terminal domain of human rpa32 complexed with ung2(73-88)
Deposited on 1999-12-27, released 2000-11-10
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-10, with a file datestamp of 2000-11-10.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1dpua_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dpuA (A:)
  angltvaqnqvlnlikacprpeglnfqdlknqlkhmsvssikqavdflsneghiystvdd
  dhfkstdae