PDB entry 1dpu

View 1dpu on RCSB PDB site
Description: solution structure of the c-terminal domain of human rpa32 complexed with ung2(73-88)
Class: DNA binding protein
Keywords: protein-peptide complex, DNA repair, nmr, DNA binding protein
Deposited on 1999-12-27, released 2000-11-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: replication protein a (rpa32) c-terminal domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dpua_
  • Chain 'B':
    Compound: uracil DNA glycosylase (ung2)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dpuA (A:)
    ansqpsagrapisnpgmseagnfggnsfmpangltvaqnqvlnlikacprpeglnfqdlk
    nqlkhmsvssikqavdflsneghiystvdddhfkstdae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dpuA (A:)
    angltvaqnqvlnlikacprpeglnfqdlknqlkhmsvssikqavdflsneghiystvdd
    dhfkstdae
    

  • Chain 'B':
    No sequence available.