PDB entry 1dpu

View 1dpu on RCSB PDB site
Description: solution structure of the c-terminal domain of human rpa32 complexed with ung2(73-88)
Class: DNA binding protein
Keywords: protein-peptide complex, DNA repair, nmr, DNA binding protein
Deposited on 1999-12-27, released 2000-11-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: replication protein a (rpa32) c-terminal domain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15927 (Start-98)
  Domains in SCOPe 2.08: d1dpua_
• Chain 'B':
  Compound: uracil DNA glycosylase (ung2)
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13051 (0-15)

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1dpuA (A:)
  ansqpsagrapisnpgmseagnfggnsfmpangltvaqnqvlnlikacprpeglnfqdlk
  nqlkhmsvssikqavdflsneghiystvdddhfkstdae
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1dpuA (A:)
  angltvaqnqvlnlikacprpeglnfqdlknqlkhmsvssikqavdflsneghiystvdd
  dhfkstdae
  

  
  
• Chain 'B':
  No sequence available.