PDB entry 1dpt

View 1dpt on RCSB PDB site
Description: d-dopachrome tautomerase
Class: cytokine
Keywords: cytokine, growth factor, tautomerase
Deposited on 1998-05-11, released 1999-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.164
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-dopachrome tautomerase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dpta_
  • Chain 'B':
    Compound: D-dopachrome tautomerase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dptb_
  • Chain 'C':
    Compound: D-dopachrome tautomerase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dptc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dptA (A:)
    pfleldtnlpanrvpaglekrlcaaaasilgkpadrvnvtvrpglamalsgstepcaqls
    issigvvgtaednrshsahffefltkelalgqdrilirffpleswqigkigtvmtfl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dptB (B:)
    pfleldtnlpanrvpaglekrlcaaaasilgkpadrvnvtvrpglamalsgstepcaqls
    issigvvgtaednrshsahffefltkelalgqdrilirffpleswqigkigtvmtfl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dptC (C:)
    pfleldtnlpanrvpaglekrlcaaaasilgkpadrvnvtvrpglamalsgstepcaqls
    issigvvgtaednrshsahffefltkelalgqdrilirffpleswqigkigtvmtfl