PDB entry 1dps

View 1dps on RCSB PDB site
Description: the crystal structure of dps, a ferritin homolog that binds and protects dna
Deposited on 1998-02-23, released 1998-09-16
The last revision prior to the SCOP 1.69 freeze date was dated 1998-09-16, with a file datestamp of 1998-09-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.188
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1dpsa_
  • Chain 'B':
    Domains in SCOP 1.69: d1dpsb_
  • Chain 'C':
    Domains in SCOP 1.69: d1dpsc_
  • Chain 'D':
    Domains in SCOP 1.69: d1dpsd_
  • Chain 'E':
    Domains in SCOP 1.69: d1dpse_
  • Chain 'F':
    Domains in SCOP 1.69: d1dpsf_
  • Chain 'G':
    Domains in SCOP 1.69: d1dpsg_
  • Chain 'H':
    Domains in SCOP 1.69: d1dpsh_
  • Chain 'I':
    Domains in SCOP 1.69: d1dpsi_
  • Chain 'J':
    Domains in SCOP 1.69: d1dpsj_
  • Chain 'K':
    Domains in SCOP 1.69: d1dpsk_
  • Chain 'L':
    Domains in SCOP 1.69: d1dpsl_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dpsA (A:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dpsA (A:)
    skatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldg
    frtalidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaiv
    andvrkaigeakdddtadiltaasrdldkflwfiecnie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dpsB (B:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dpsB (B:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiecnie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dpsC (C:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dpsC (C:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiecnie
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dpsD (D:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dpsD (D:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiecnie
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1dpsE (E:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dpsE (E:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiecnie
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1dpsF (F:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dpsF (F:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiecnie
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1dpsG (G:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dpsG (G:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiecnie
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1dpsH (H:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dpsH (H:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiecnie
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1dpsI (I:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dpsI (I:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiecnie
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1dpsJ (J:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dpsJ (J:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiecnie
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1dpsK (K:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dpsK (K:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiecnie
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1dpsL (L:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiecnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dpsL (L:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiecnie