PDB entry 1dpr

View 1dpr on RCSB PDB site
Description: structures of the apo-and metal ion activated forms of the diphtheria tox repressor from corynebacterium diphtheriae
Class: transcription regulation
Keywords: diphtheria, virulence, DNA-binding, iron-regulation repressor, transcription regulation
Deposited on 1995-02-06, released 1995-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-07.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.241
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diphtheria tox repressor
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dpra1, d1dpra2
  • Chain 'B':
    Compound: diphtheria tox repressor
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dprb1, d1dprb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dprA (A:)
    mkdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
    slqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvl
    kdvsrspfgnpipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqft
    qlldadirvgseveivdrdghitlshngkdvellddlahtirieel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dprA (A:)
    dlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrsl
    qmtptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkd
    vsrspfgnpipgld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dprB (B:)
    mkdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
    slqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvl
    kdvsrspfgnpipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqft
    qlldadirvgseveivdrdghitlshngkdvellddlahtirieel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dprB (B:)
    dlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrsl
    qmtptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkd
    vsrspfgnpipgld