PDB entry 1dpp

View 1dpp on RCSB PDB site
Description: dipeptide binding protein complex with glycyl-l-leucine
Class: peptide binding protein
Keywords: chemotaxis, complex (binding protein/peptide) complex, peptide binding protein
Deposited on 1995-08-11, released 1995-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.223
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptide binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dppa_
  • Chain 'C':
    Compound: dipeptide binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dppc_
  • Chain 'E':
    Compound: dipeptide binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dppe_
  • Chain 'G':
    Compound: dipeptide binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dppg_
  • Heterogens: GLY, LEU

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dppA (A:)
    ktlvycsegspegfnpqlftsgttydassvplynrlvefkigttevipglaekwevsedg
    ktytfhlrkgvkwhdnkefkptrelnaddvvfsfdrqknaqnpyhkvsggsyeyfegmgl
    pelisevkkvddntvqfvltrpeapfladlamdfasilskeyadammkagtpekldlnpi
    gtgpfqlqqyqkdsrirykafdgywgtkpqidtlvfsitpdasvryaklqknecqvmpyp
    npadiarmkqdksinlmempglnvgylsynvqkkplddvkvrqaltyavnkdaiikavyq
    gagvsaknlipptmwgynddvqdytydpekakallkeaglekgfsidlwampvqrpynpn
    arrmaemiqadwakvgvqakivtyewgeylkrakdgehqtvmmgwtgdngdpdnffatlf
    scaaseqgsnyskwcykpfedliqparatddhnkrvelykqaqvvmhdqapaliiahstv
    fepvrkevkgyvvdplgkhhfenvsie
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dppC (C:)
    ktlvycsegspegfnpqlftsgttydassvplynrlvefkigttevipglaekwevsedg
    ktytfhlrkgvkwhdnkefkptrelnaddvvfsfdrqknaqnpyhkvsggsyeyfegmgl
    pelisevkkvddntvqfvltrpeapfladlamdfasilskeyadammkagtpekldlnpi
    gtgpfqlqqyqkdsrirykafdgywgtkpqidtlvfsitpdasvryaklqknecqvmpyp
    npadiarmkqdksinlmempglnvgylsynvqkkplddvkvrqaltyavnkdaiikavyq
    gagvsaknlipptmwgynddvqdytydpekakallkeaglekgfsidlwampvqrpynpn
    arrmaemiqadwakvgvqakivtyewgeylkrakdgehqtvmmgwtgdngdpdnffatlf
    scaaseqgsnyskwcykpfedliqparatddhnkrvelykqaqvvmhdqapaliiahstv
    fepvrkevkgyvvdplgkhhfenvsie
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dppE (E:)
    ktlvycsegspegfnpqlftsgttydassvplynrlvefkigttevipglaekwevsedg
    ktytfhlrkgvkwhdnkefkptrelnaddvvfsfdrqknaqnpyhkvsggsyeyfegmgl
    pelisevkkvddntvqfvltrpeapfladlamdfasilskeyadammkagtpekldlnpi
    gtgpfqlqqyqkdsrirykafdgywgtkpqidtlvfsitpdasvryaklqknecqvmpyp
    npadiarmkqdksinlmempglnvgylsynvqkkplddvkvrqaltyavnkdaiikavyq
    gagvsaknlipptmwgynddvqdytydpekakallkeaglekgfsidlwampvqrpynpn
    arrmaemiqadwakvgvqakivtyewgeylkrakdgehqtvmmgwtgdngdpdnffatlf
    scaaseqgsnyskwcykpfedliqparatddhnkrvelykqaqvvmhdqapaliiahstv
    fepvrkevkgyvvdplgkhhfenvsie
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dppG (G:)
    ktlvycsegspegfnpqlftsgttydassvplynrlvefkigttevipglaekwevsedg
    ktytfhlrkgvkwhdnkefkptrelnaddvvfsfdrqknaqnpyhkvsggsyeyfegmgl
    pelisevkkvddntvqfvltrpeapfladlamdfasilskeyadammkagtpekldlnpi
    gtgpfqlqqyqkdsrirykafdgywgtkpqidtlvfsitpdasvryaklqknecqvmpyp
    npadiarmkqdksinlmempglnvgylsynvqkkplddvkvrqaltyavnkdaiikavyq
    gagvsaknlipptmwgynddvqdytydpekakallkeaglekgfsidlwampvqrpynpn
    arrmaemiqadwakvgvqakivtyewgeylkrakdgehqtvmmgwtgdngdpdnffatlf
    scaaseqgsnyskwcykpfedliqparatddhnkrvelykqaqvvmhdqapaliiahstv
    fepvrkevkgyvvdplgkhhfenvsie