PDB entry 1dpo

View 1dpo on RCSB PDB site
Description: structure of rat trypsin
Deposited on 1997-03-31, released 1997-07-07
The last revision prior to the SCOP 1.69 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.174
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1dpo__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dpo_ (-)
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdcggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan