PDB entry 1dpo

View 1dpo on RCSB PDB site
Description: structure of rat trypsin
Class: serine protease
Keywords: hydrolase, serine protease, digestion, pancreas, zymogen, signal, multigene family
Deposited on 1997-03-31, released 1997-07-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.174
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00763 (0-222)
      • engineered (176)
    Domains in SCOPe 2.08: d1dpoa_
  • Heterogens: CA, SO4, BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dpoA (A:)
    ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
    wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdcggp
    vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan