PDB entry 1dpm

View 1dpm on RCSB PDB site
Description: three-dimensional structure of the zinc-containing phosphotriesterase with bound substrate analog diethyl 4-methylbenzylphosphonate
Class: hydrolase
Keywords: hydrolase, membrane, plasmid, signal, zinc
Deposited on 1996-02-13, released 1997-08-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.154
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphotriesterase
    Species: Brevundimonas diminuta [TaxId:293]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dpma_
  • Chain 'B':
    Compound: phosphotriesterase
    Species: Brevundimonas diminuta [TaxId:293]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dpmb_
  • Heterogens: ZN, EBP, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dpmA (A:)
    arintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraag
    vrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflrei
    qygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqaa
    ifeseglspsrvcighsddtddlsyltalaargyligldhiphsaiglednasasallgi
    rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvip
    flrekgvpqetlagitvtnparflsptlr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dpmB (B:)
    arintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraag
    vrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflrei
    qygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqaa
    ifeseglspsrvcighsddtddlsyltalaargyligldhiphsaiglednasasallgi
    rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvip
    flrekgvpqetlagitvtnparflsptlr