PDB entry 1dpj

View 1dpj on RCSB PDB site
Description: the structure of proteinase a complexed with ia3 peptide inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: proteinase A, IA3 peptide, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 1999-12-27, released 2000-05-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proteinase a
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1dpja_
  • Chain 'B':
    Compound: proteinase inhibitor ia3 peptide
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1dpjb_
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dpjA (A:)
    gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
    asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg
    ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk
    gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga
    kkgwtgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp
    laivgdaflrkyysiydlgnnavglakai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dpjB (B:)
    ntdqqkvseifqsskeklqgdakvvsdafkkma
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dpjB (B:)
    tdqqkvseifqsskeklqgdakvvsdafk