PDB entry 1dpj

View 1dpj on RCSB PDB site
Description: the structure of proteinase a complexed with ia3 peptide inhibitor
Deposited on 1999-12-27, released 2000-05-03
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-03, with a file datestamp of 2000-05-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dpja_
  • Chain 'B':
    Domains in SCOP 1.55: d1dpjb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dpjA (A:)
    gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
    asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg
    ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk
    gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga
    kkgwtgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp
    laivgdaflrkyysiydlgnnavglakai
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dpjB (B:)
    tdqqkvseifqsskeklqgdakvvsdafk