PDB entry 1dpi

View 1dpi on RCSB PDB site
Description: structure of large fragment of escherichia coli dna polymerase i complexed with d/tmp
Deposited on 1987-08-11, released 1987-10-16
The last revision prior to the SCOP 1.67 freeze date was dated 1987-10-16, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.2
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1dpi_ (-)
    visydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
    pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
    lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
    vtlqlhlkmwpdlqkhkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrl
    aelekkaheiageefnlsstkqlqtilfekqgikplkktpggapstseevleelaldypl
    pkvileyrglaklkstytdklplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrn
    eegrrirqafiapedyvivsadysqielrimahlsrdkglltafaegkdihrataaevfg
    lpletvtseqrrsakainfgliygmsafglarqlniprkeaqkymdlyferypgvleyme
    rtraqakeqgyvetldgrrlylpdikssngarraaaeraainapmqgtaadiikramiav
    dawlqaeqprvrmimqvhdelvfevhkddvdavakqihqlmenctrldvpllvevgsgen
    wdqah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dpi_ (-)
    sydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayipv
    ahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtmle
    syilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedadvt
    lqlhlkmwpdlqkhkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrlae
    lekkaheilpkvileyrglaklkstytdklplminpktgrvhtsyhqavtatgrlsstdp
    nlqnipvrneegrrirqafiapedyvivsadysqielrimahlsrdkglltafaegkdih
    rataaevfglpletvtseqrrsakainfgliygmsafglarqlnimdlyferypgvleym
    ertraqakeqgyvetldgrrlylpdikssngarraaaeraainapmqgtaadiikramia
    vdawlqaeqprvrmimqvhdelvfevhkddvdavakqihqlmenctrldvpllvevgsge
    nwdqah