PDB entry 1dph

View 1dph on RCSB PDB site
Description: conformational changes in cubic insulin crystals in the ph range 7-11
Class: hormone
Keywords: hormone
Deposited on 1992-10-30, released 1993-01-15
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin a chain (ph 11)
  Species: Bos taurus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01317 (0-20)
  Domains in SCOP 1.73: d1dph.1
• Chain 'B':
  Compound: insulin b chain (ph 11)
  Species: Bos taurus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01317 (0-29)
  Domains in SCOP 1.73: d1dph.1
• Heterogens: NA, DCE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dphA (A:)
  giveqccasvcslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dphB (B:)
  fvnqhlcgshlvealylvcgergffytpka