PDB entry 1dpg

View 1dpg on RCSB PDB site
Description: glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides
Class: oxidoreductase (choh(d) - nad(p))
Keywords: oxidoreductase, nadp/nad, glucose metabolism
Deposited on 1995-12-04, released 1996-03-08
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucose 6-phosphate dehydrogenase
    Species: Leuconostoc mesenteroides
    Gene: G6PD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11411 (0-484)
      • engineered (60)
    Domains in SCOP 1.75: d1dpga1, d1dpga2
  • Chain 'B':
    Compound: glucose 6-phosphate dehydrogenase
    Species: Leuconostoc mesenteroides
    Gene: G6PD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11411 (0-484)
      • engineered (60)
    Domains in SCOP 1.75: d1dpgb1, d1dpgb2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dpgA (A:)
    vseiktlvtffggtgdlakrklypsvfnlykkgylqkhfaivgtarqalnddefkqlvrd
    cikdftddqaqaeafiehfsyrahdvtdaasyavlkeaieeaadkfdidgnrifymsvap
    rffgtiakylkseglladtgynrlmiekpfgtsydtaaelqndlenafddnqlfridhyl
    gkemvqniaalrfgnpifdaawnkdyiknvqvtlsevlgveeragyydtagalldmiqnh
    tmqivgwlamekpesftdkdiraaknaafnalkiydeaevnkyfvraqygagdsadfkpy
    leeldvpadsknntfiagelqfdlprwegvpfyvrsgkrlaakqtrvdivfkagtfnfgs
    eqeaqeavlsiiidpkgaielklnaksvedafntrtidlgwtvsdedkkntpepyermih
    dtmngdgsnfadwngvsiawkfvdaisavytadkapletyksgsmgpeasdkllaangda
    wvfkg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dpgB (B:)
    vseiktlvtffggtgdlakrklypsvfnlykkgylqkhfaivgtarqalnddefkqlvrd
    cikdftddqaqaeafiehfsyrahdvtdaasyavlkeaieeaadkfdidgnrifymsvap
    rffgtiakylkseglladtgynrlmiekpfgtsydtaaelqndlenafddnqlfridhyl
    gkemvqniaalrfgnpifdaawnkdyiknvqvtlsevlgveeragyydtagalldmiqnh
    tmqivgwlamekpesftdkdiraaknaafnalkiydeaevnkyfvraqygagdsadfkpy
    leeldvpadsknntfiagelqfdlprwegvpfyvrsgkrlaakqtrvdivfkagtfnfgs
    eqeaqeavlsiiidpkgaielklnaksvedafntrtidlgwtvsdedkkntpepyermih
    dtmngdgsnfadwngvsiawkfvdaisavytadkapletyksgsmgpeasdkllaangda
    wvfkg