PDB entry 1dpf

View 1dpf on RCSB PDB site
Description: crystal structure of a mg-free form of rhoa complexed with GDP
Class: gene regulation/signaling protein
Keywords: protein rhoa-GDP complex, gene regulation/signaling protein complex
Deposited on 1999-12-27, released 2000-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rhoa
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61586 (Start-179)
      • mutation (13)
    Domains in SCOPe 2.07: d1dpfa_
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dpfA (A:)
    maairkklvivgdvacgktcllivfskdqfpavyvptvfenyvadievdgkqvelalwdt
    agqedydrarplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd
    lrndehtarelakmkqepvkpaegrdmanrigafgymecsaktkdgvrevfematraalq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dpfA (A:)
    airkklvivgdvacgktcllivfskdqfpavyvptvfenyvadievdgkqvelalwdtag
    qedydrarplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
    ndehtarelakmkqepvkpaegrdmanrigafgymecsaktkdgvrevfematraalq