PDB entry 1dpc

View 1dpc on RCSB PDB site
Description: crystallographic and enzymatic investigations on the role of ser558, his610 and asn614 in the catalytic mechanism of azotobacter vinelandii dihydrolipoamide acetyltransferase (e2p)
Class: dihydrolipoamide acetyltransferase
Keywords: dihydrolipoamide acetyltransferase
Deposited on 1995-02-03, released 1995-04-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.184
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrolipoyl-transacetylase
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10802 (0-242)
      • conflict (219)
    Domains in SCOPe 2.03: d1dpca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dpcA (A:)
    ippippvdfakygeieevpmtrlmqigatnlhrswlnvphvtqfesaditeleafrvaqk
    avaekagvkltvlplllkacayllkelpdfnsslapsgqalirkkyvhigfavdtpdgll
    vpvirnvdqksllqlaaeaaelaekarskklgadamqgacftisslghiggtaftpivna
    pevailgvskasmqpvwdgkafqprlmlplslsydhrvidgaaaarftkrlgdlladira
    ill