PDB entry 1dp9

View 1dp9 on RCSB PDB site
Description: crystal structure of imidazole-bound fixl heme domain
Class: oxygen storage/transport
Keywords: heme, fixl heme domain liganded structure, pas domain family, two component system, histidine kinase
Deposited on 1999-12-24, released 2000-12-24
The last revision prior to the SCOP 1.73 freeze date was dated 2000-12-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.195
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fixl protein
    Species: Bradyrhizobium japonicum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1dp9a_
  • Heterogens: IMD, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dp9A (A:)
    mrethlrsilhtipdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsr
    hdsyisryrttsdphiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdlteh
    qqtqarlqelq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dp9A (A:)
    damividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsdp
    hiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqel