PDB entry 1dp8

View 1dp8 on RCSB PDB site
Description: crystal structure of the nitric oxide bound fixl heme domain
Class: oxygen storage/transport
Keywords: heme, fixl heme domain liganded structures, histidine kinase, signal transduction, two component system
Deposited on 1999-12-24, released 2000-12-24
The last revision prior to the SCOP 1.73 freeze date was dated 2000-12-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.205
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fixl protein
    Species: Bradyrhizobium japonicum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1dp8a_
  • Heterogens: NO, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dp8A (A:)
    mrethlrsilhtipdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsr
    hdsyisryrttsdphiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdlteh
    qqtqarlqelq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dp8A (A:)
    pdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsd
    phiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqelq