PDB entry 1dp8

View 1dp8 on RCSB PDB site
Description: crystal structure of the nitric oxide bound fixl heme domain
Deposited on 1999-12-24, released 2000-12-24
The last revision prior to the SCOP 1.57 freeze date was dated 2000-12-24, with a file datestamp of 2000-12-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.205
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1dp8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dp8A (A:)
    pdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsd
    phiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqelq