PDB entry 1dp7

View 1dp7 on RCSB PDB site
Description: cocrystal structure of rfx-dbd in complex with its cognate x-box binding site
Class: transcription/DNA
Keywords: winged helix, MHC class II transcription factor, protein-DNA cocrystal structure, novel mode of DNA recognition, transcription-DNA complex
Deposited on 1999-12-23, released 2000-03-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: DNA (5'-d(*cp*gp*(bru)p*tp*ap*cp*cp*ap*(bru)p*gp*gp*tp*ap*ap*cp*g)-3')
  • Chain 'P':
    Compound: MHC class II transcription factor hrfx1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22670 (0-75)
      • engineered (23)
      • engineered (29)
    Domains in SCOPe 2.08: d1dp7p_
  • Heterogens: EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'D':
    No sequence available.

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dp7P (P:)
    tvqwlldnyetaegvslprstlynhyllhsqeqklepvnaasfgklirsvfmglrtrrlg
    trgnskyhyyglrika