PDB entry 1dp6

View 1dp6 on RCSB PDB site
Description: oxygen-binding complex of fixl heme domain
Class: oxygen storage/transport
Keywords: fixl, heme, pas domain, signal transduction, histidine kinase
Deposited on 1999-12-23, released 2000-12-23
The last revision prior to the SCOP 1.73 freeze date was dated 2000-12-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.206
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fixl protein
    Species: Bradyrhizobium japonicum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1dp6a_
  • Heterogens: OXY, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1dp6A (A:)
mrethlrsilhtipdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsr
hdsyisryrttsdphiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdlteh
qqtqarlqelq

    Sequence, based on observed residues (ATOM records): (download) 
    >1dp6A (A:)
damividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsdp
hiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqel