PDB entry 1dp6

View 1dp6 on RCSB PDB site
Description: oxygen-binding complex of fixl heme domain
Deposited on 1999-12-23, released 2000-12-23
The last revision prior to the SCOP 1.71 freeze date was dated 2000-12-23, with a file datestamp of 2000-12-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.206
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1dp6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dp6A (A:)
    mrethlrsilhtipdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsr
    hdsyisryrttsdphiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdlteh
    qqtqarlqelq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dp6A (A:)
    damividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsdp
    hiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqel