PDB entry 1dp6

View 1dp6 on RCSB PDB site
Description: oxygen-binding complex of fixl heme domain
Class: oxygen storage/transport
Keywords: fixl, heme, pas domain, signal transduction, histidine kinase, oxygen storage/transport complex
Deposited on 1999-12-23, released 2000-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.206
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fixl protein
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dp6a_
  • Heterogens: OXY, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dp6A (A:)
    mrethlrsilhtipdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsr
    hdsyisryrttsdphiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdlteh
    qqtqarlqelq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dp6A (A:)
    damividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsdp
    hiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqel