PDB entry 1dp5

View 1dp5 on RCSB PDB site
Description: the structure of proteinase a complexed with a ia3 mutant inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: Proteinase A, MMM, IA3 mutant, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 1999-12-23, released 2000-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.188
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proteinase a
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dp5a_
  • Chain 'B':
    Compound: proteinase inhibitor ia3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01094
      • engineered (30-31)
    Domains in SCOPe 2.07: d1dp5b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dp5A (A:)
    gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
    asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg
    ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk
    gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga
    kkgwtgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp
    laivgdaflrkyysiydlgnnavglakai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dp5B (B:)
    mntdqqkvseifqsskeklqgdakvvsdafmmmasqdkdgkttdadesekhnyqeqynkl
    kgaghkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dp5B (B:)
    ntdqqkvseifqsskeklqgdakvvsdafmm