PDB entry 1dp4

View 1dp4 on RCSB PDB site
Description: dimerized hormone binding domain of the atrial natriuretic peptide receptor
Class: hormone/growth factor receptor, lyase
Keywords: periplasmic binding protein fold, dimer, HORMONE/GROWTH FACTOR RECEPTOR, LYASE COMPLEX, HORMONE-GROWTH FACTOR RECEPTOR
Deposited on 1999-12-23, released 2000-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Atrial natriuretic peptide receptor A
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dp4a_
  • Chain 'C':
    Compound: Atrial natriuretic peptide receptor A
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dp4c_
  • Heterogens: NAG, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dp4A (A:)
    sdltvavvlpltntsypwswarvgpavelalarvkarpdllpgwtvrmvlgssenaagvc
    sdtaaplaavdlkwehspavflgpgcvysaapvgrftahwrvplltagapalgigvkdey
    alttrtgpshvklgdfvtalhrrlgwehqalvlyadrlgddrpcffiveglymrvrerln
    itvnhqefvegdpdhypkllravrrkgrviyicsspdafrnlmllalnagltgedyvffh
    ldvfgqslksaqglvpqkpwergdgqdrsarqafqaakiitykepdnpeyleflkqlkll
    adkkfnftvedglkniipasfhdglllyvqavtetlaqggtvtdgenitqrmwnrsfqgv
    tgylkidrngdrdtdfslwdmdpetgafrvvlnyngtsqelmavsehklywplgypppdv
    pkcgfdnedpacnqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dp4A (A:)
    sdltvavvlpltntsypwswarvgpavelalarvkarpdllpgwtvrmvlgssenaagvc
    sdtaaplaavdlkwehspavflgpgcvysaapvgrftahwrvplltagapalgigvkdey
    alttrtgpshvklgdfvtalhrrlgwehqalvlyadrlgddrpcffiveglymrvrerln
    itvnhqefvegdpdhypkllravrrkgrviyicsspdafrnlmllalnagltgedyvffh
    ldvfgqslksaqglvpqkpwergdgqdrsarqafqaakiitykepdnpeyleflkqlkll
    adkkfnftvedglkniipasfhdglllyvqavtetlaqggtvtdgenitqrmwnrsfqgv
    tgylkidrngdrdtdfslwdmdpetgafrvvlnyngtsqelmavsehklywplgypppdv
    pkcgf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dp4C (C:)
    sdltvavvlpltntsypwswarvgpavelalarvkarpdllpgwtvrmvlgssenaagvc
    sdtaaplaavdlkwehspavflgpgcvysaapvgrftahwrvplltagapalgigvkdey
    alttrtgpshvklgdfvtalhrrlgwehqalvlyadrlgddrpcffiveglymrvrerln
    itvnhqefvegdpdhypkllravrrkgrviyicsspdafrnlmllalnagltgedyvffh
    ldvfgqslksaqglvpqkpwergdgqdrsarqafqaakiitykepdnpeyleflkqlkll
    adkkfnftvedglkniipasfhdglllyvqavtetlaqggtvtdgenitqrmwnrsfqgv
    tgylkidrngdrdtdfslwdmdpetgafrvvlnyngtsqelmavsehklywplgypppdv
    pkcgfdnedpacnqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dp4C (C:)
    sdltvavvlpltntsypwswarvgpavelalarvkarpdllpgwtvrmvlgssenaagvc
    sdtaaplaavdlkwehspavflgpgcvysaapvgrftahwrvplltagapalgigvkdey
    alttrtgpshvklgdfvtalhrrlgwehqalvlyadrlgddrpcffiveglymrvrerln
    itvnhqefvegdpdhypkllravrrkgrviyicsspdafrnlmllalnagltgedyvffh
    ldvfgqslkpqkpwergdgqdrsarqafqaakiitykepdnpeyleflkqlklladkkfn
    ftvedglkniipasfhdglllyvqavtetlaqggtvtdgenitqrmwnrsfqgvtgylki
    drngdrdtdfslwdmdpetgafrvvlnyngtsqelmavsehklywplgypppdvpkcgfd
    nedpacnqd